← Back to Home

xelebrity.com Scam Check: 25/100 Trust | ScamMinder

Website: xelebrity.com

Screenshot of xelebrity.com

Safety Score

25/100
✗ Scam Risk

Exercise caution when interacting with this website.

AI Analysis Results

Category: Adult Entertainment
About this website:

Detailed Analysis Report: Is xelebrity.com Safe and Legit? Website Overview and Purpose xelebrity.com is an adult entertainment platform that offers live webcam services featuring amateur and professional performers. The site allows users to engage in live chats and private shows, primarily targeting an adult audience looking for interactive adult content. Content Quality and User Experience Key Experience Highlights Live streaming capabilities with various performers categorized by gender and preferences. Age verification process for users in specific regions, ensuring compliance with legal requirements. Interactive features such as tipping and private shows to enhance user engagement. Regular updates and promotional events to attract and retain users. Claims Verification and Red Flags ⚠️ Red Flags Detected Several red flags have been identified that raise concerns about the legitimacy of the site: Age Verification Process: The site requires users to verify their age, which can be a tactic to collect sensitive personal information. Content Quality: The site features explicit content that may not be suitable for all users, raising ethical concerns. Domain Age: The domain is 8 years old, which is relatively young for a site in this industry, potentially indicating a lack of established reputation. High-Risk Category: Adult entertainment sites often face scrutiny for compliance with legal and ethical standards. Unverified Claims: The site makes various claims about user engagement and performer quality without providing verifiable evidence. ⚠️ Caution Points Users should be cautious about sharing personal information during the age verification process. Consider the legal implications of accessing adult content in your region. Be aware of potential scams or fraudulent activities associated with adult entertainment platforms. Security Note: The site uses a basic SSL certificate, which does not guarantee the legitimacy of the business. Legitimacy and Reputation Assessment The domain has been operational for 8 years , indicating some level of stability. However, it lacks a strong reputation in the adult entertainment industry, as evidenced by its absence from major rankings or reviews. The site is hosted in the United States, but there are no clear indicators of regulatory compliance or transparency regarding ownership. Final Verdict and Recommendations Conclusion: xelebrity.com raises multiple red flags that suggest it may not be a safe or legitimate platform for users. Caution is advised when engaging with adult entertainment sites, especially those that require personal information for age verification. Users should consider alternative platforms with better reputations and transparency regarding their operations.

Risk Assessment: scam
⚠️ Red Flags:
  • [GUARDRAIL] No deterministic evidence for scam; downgrading to warning
  • [CLAIMS] Age verification process may be a tactic to collect sensitive personal information.
  • [CONTENT QUALITY] Explicit content may not be suitable for all users, raising ethical concerns.
  • [BUSINESS MODEL] High-risk category for adult entertainment sites, often associated with scams.
📊 Analysis Reasons:
  • [BUSINESS MODEL] The site operates in the high-risk adult entertainment sector, which often faces scrutiny for compliance and ethical issues.
  • [TRANSPARENCY] Lack of clear ownership information and regulatory compliance raises concerns about legitimacy.
  • [DOMAIN HISTORY] The domain is 8 years old, which is relatively young for an adult site, indicating a lack of established reputation.
  • [SECURITY] Basic SSL certificate in use, which does not guarantee the site's legitimacy or security.
  • [CLAIMS] The site makes unverifiable claims about user engagement and performer quality, which is common in scam patterns.
🛡️ Safety Actions Applied:
  • {"type":"scam_downgraded","reason":"No deterministic evidence for scam; downgrading to warning","scoreCeiling":null,"targetStatus":"warning"}
Score Source: openai_guardrail
AI Confidence: medium

Technical Details

\n \n\n\n\n\n\n\n\n\n \n \n \n\n \n\n \n\n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n\n \n \n \n \n \n \n \n Chaturbate - Free Adult Webcams, Live Sex, Free Sex Chat, Exhibitionist & Pornstar Free Cams\n \n \n \n \n \n\n\n \n \n \n \n \n \n \n \n \n \n \n \n\n \n\n \n \n\n \n \n \n\n \n \n\n \n \n \n \n \n \n \n \n \n \n\n \n \n \n\n \n \n \n \n\n\n \n \n \n\n\n\n\n\n \n \n\n\n\n\n\n \n\n\n
\n\n \n\n \n\n\n\n \n \n\n
\n\n \n\n
\n
\n \n Verify your age\n \n
\n \n \n Visitors in Florida must verify their age to access Chaturbate.\n This process will take under 1 minute.\n \n \n \n
\n

\nAlthough this platform is, and has always been, for adults only, as it appears you are accessing the platform from Florida, you will need to take the additional step of verifying your age. For your information, your verification information or image is not provided to or reviewed by the platform. We receive only confirmation that you have successfully verified your age.\n

\n

\n\n\n \n The law does not — by its own terms — apply to any Internet service provider or cloud service provider that solely provides access to content from a facility (in this case, a webcam) not under its control.\n \n This platform is not responsible for the creation or production of any of the content appearing through the platform. Our sole functions with respect to the platform are to ensure its effective operation (notably, ensuring that the content and users comply with the Terms of Service) and safety of the community (most importantly, ensuring that no minors appear through the platform).\n\n

\n
\n
\n \n
\n \n
\n
\n \n \n
\n
\n
\n \n
\n

Verify your age by taking a photo of your driver's license or passport. This image will not be provided to us and will be discarded by Incode immediately after confirming your age.

\n
\n
\n
\n
\n \n
\n \n
\n \n
\n
\n \n \n
\n
\n
\n \n
\n

Verify your age using the Yoti app. Yoti will store your identification information to make future verifications simpler.

\n
\n
\n
\n
\n \n
\n \n \n \n Other verification methods\n \"caret\"\n \n \n \n
\n \n Confirm Age\n \n \n
\n\n\n\n\n\n
\n\n\n\n\n\n\n \n\n\n \n\n\n\n \n\n\n \n\n\n\n\n\n\n\n\n\n
\n
\n \n\n\n\n
\n
\n
\n \n \n \n \n \n \n \n \n \n \n \n THE ACT OF MASTURBATING WHILE CHATTING ONLINE\n \n
\n\n \n\n
\n
\n
\n
\n \"Anonymous\n \n \n
\n\n \n
\n \n \n \n \n
\n \n \n \n
\n \n \n
\n \n
Updates
How Can We Improve?
\n
\n \n \n \n \n \n \n \n\n\n \n \n \n \n
Status:\n \n Anonymous\n \n (Log In)
You have:\n
\n \n \n\n 0 Tokens\n\n \n \n
\n 		\n (Get More)\n
\n
\n
\n
\n\n
\n\n \n
\n \n
\n \n
\n\n\n\n\n\n
\n
\n
\n
\n We noticed you're using a web browser that we don't support. Upgrade to a recent version of
Chrome, Firefox, or Safari for a better online experience. (dismiss)\n
\n
\n
\n \n \n \n \n \n \n\n \n \n \n \n \n
\n\n \n
\n \n \n \n
\n \n \n\n \n\n
    \n
  • \n \n
    • \n \n \n
  • \n
    \n
    \n
    \n
    \n
    \n
    • \n \n
    Filters
\n\n\n
\n
REGIONS
North AmericaSouth AmericaAsiaEurope/RussiaOther
ROOM SIZE
IntimateMid-SizedHigh-Traffic
TAGS
ebonybigboobsasian18maturemilfanalsquirtlatinanewhairybbwteenbigassfuckmachineskinnydeepthroattaboocalgarysmalltitsfeetmilkpinayyoungpregnantpantyhosebigcockbritishgermanfemboybbcmistressgothmusclecurvyindianlesbianredheadsmokeshyc2cnaturalblondelovensecumnonudebigpussylipsfrench
1
of
23
1 / 23
next
AGES
(reset)

to

apply
PRIVATE SHOW TOKENS PER MINUTE
6 tks12 - 18 tks30 - 42 tks60 - 72 tks90+ tks
\n
\n \n \n\n
\n

Options

Upgrade to supporter to use this feature.
\n
\n
\n\n \n
\n \n \n\n\n

Online Rooms

Offline Rooms

Clear All
Search results for \"\"

No Results Found - None of the 9,554 live rooms matched your filters. Please update your search/filter options.
Suggestions:
  • Remove some of the filter options
  • Try different filters
  • Clear all filters

Something went wrong while loading the rooms. Please refresh the page to try again.

8437 of the 9554 live rooms matched your filters

Community Controlled Shows

No Results Found - None of the 0 live rooms matched your filters. Please update your search/filter options.
Suggestions:
  • Remove some of the filter options
  • Try different filters
  • Clear all filters

Something went wrong while loading the rooms. Please refresh the page to try again.

    None of the undefined community controlled rooms matched your filters
      • ...
    • 1
      • ...

    Recommended For You

      Other Featured Cams:

      Something went wrong while loading the rooms. Please refresh the page to try again.

        \n\n
        \n\n\n
        \n \n
        \n \n\n
        \n
        \n

        Free Cams by Age

        \n \n \n\n\n
        \n \n
        \n Teen Cams (18+)\n
        \n \n
        \n 18 to 21 Cams\n
        \n \n
        \n 20 to 30 Cams\n
        \n \n
        \n 30 to 50 Cams\n
        \n \n
        \n Mature Cams (50+)\n
        \n \n
        \n\n\n
        \n
        \n

        Free Cams by Region

        \n \n \n\n\n
        \n \n
        \n North American Cams\n
        \n \n
        \n Other Region Cams\n
        \n \n
        \n Euro Russian Cams\n
        \n \n
        \n Asian Cams\n
        \n \n
        \n South American Cams\n
        \n \n
        \n\n\n
        \n
        \n

        Available Private Shows

        \n \n \n\n\n
        \n \n
        \n 6 Tokens per Minute\n
        \n \n
        \n 12-18 Tokens per Minute\n
        \n \n
        \n 30-42 Tokens per Minute\n
        \n \n
        \n 60-72 Tokens per Minute\n
        \n \n
        \n 90+ Tokens per Minute\n
        \n \n
        \n\n\n
        \n
        \n

        Free Cams by Status

        \n \n \n\n\n
        \n \n
        \n Private Shows\n
        \n \n
        \n New Cams\n
        \n \n
        \n Gaming Cams\n
        \n \n
        \n\n\n
        \n
        \n

        Free Cams

        \n \n \n\n\n
        \n \n
        \n Featured Cams\n
        \n \n
        \n Female Cams\n
        \n \n
        \n Male Cams\n
        \n \n
        \n Couple Cams\n
        \n \n
        \n Trans Cams\n
        \n \n
        \n\n\n
        \n
        \n\n \n \n \n \n \n \n \n\n

        18 U.S.C. 2257 Record Keeping Requirements Compliance Statement

        \n\n
        \n\n\n

        © Copyright Chaturbate.com 2011 - 2025. All Rights Reserved.
        www3-ext-bh0x:6228161b7f8f:99b6da362bac67cc-MIA

        \n

        \n \"Safe\n \"RTA\n \"Approved\n

        \n\n \n
        \n \n \n \n
        \n\n\n\n\n\n\n\n \n\n\n\n\n\n\n \n \n \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n \n \n \n \n \n\n\n\n\n\n\n\n\n\n \n\n\n\n\n\n\n\n\n\n\n\n\n \n \n \n \n \n \n \n \n \n \n \n\n\n\n\n\n\n\n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n
        \n \n \n \n\n\n
        \n\n\n\n\n\n\n\n\n \n
        \n\n\n\n\n
        ","screenshot":"https://cdn.scamminder.com/include/uploads/2025/11/xelebrity.com-20251108-124006.webp","loadTimeInSeconds":12.007,"title":"Chaturbate - Free Adult Webcams, Live Sex, Free Sex Chat, Exhibitionist & Pornstar Free Cams","keywords":"free cams, free adult video chat, free sex webcams, live adult cams, adult webcams, free live porn","description":"Enjoy free chat and live webcam broadcasts from amateurs around the world. No registration required!","links":["https://xelebrity.com/agegate/incode/?key=gAAAAABpD4BiaKtWq1WqRIoUoY0NsL34-i-mD5vUE4NtmHyRQ5We_hKzCdOT7KVk6aLHztYzhy7aRqu40hgM2xkkakyfLVTz_JyhrvV50xgufUKdZCcno1Ewq01v8TFpAXJtHvDNGgsP&method=incode","https://xelebrity.com/auth/login","https://xelebrity.com","https://xelebrity.com/accounts/register/?src=header","https://xelebrity.com/tipping/purchase_tokens/?source=TokenSourceUserInfoPanel","https://xelebrity.com/accounts/register/?src=header&auipsrc=navbar&next=%2Frosyemily%2F%3Fcampaign%3DQuUeA%26disable_sound%3D0%26join_overlay%3D1%26tour%3Dhr8m%26track%3Dxepebrity","https://xelebrity.com/discover","https://xelebrity.com/tags","https://xelebrity.com/spy-on-cams","https://xelebrity.com/followed-cams","https://xelebrity.com/accounts/register/?src=broadcast&next=/b","https://xelebrity.com/supporter/upgrade/?source=SupporterSourcePreviewRoomsUpsell","https://xelebrity.com/vanandjuani","https://xelebrity.com/midnightmeld","https://xelebrity.com/sweetjona","https://xelebrity.com/sexyaisha31","https://xelebrity.com/madnessalise","https://xelebrity.com/pacho_stormie","https://xelebrity.com/heybanan","https://xelebrity.com/bunnyclide","https://xelebrity.com/wet_pussyasian","https://xelebrity.com/chaptertoo","https://xelebrity.com/your_kat","https://xelebrity.com/kent_mod","https://xelebrity.com/luna_liu520","https://xelebrity.com/tinacb","https://xelebrity.com/onlykira","https://xelebrity.com/notfallenangel","https://xelebrity.com/cutieeeeva","https://xelebrity.com/somniya","https://xelebrity.com/reecemarie","https://xelebrity.com/jokkeer69","https://xelebrity.com/hannahjames710","https://xelebrity.com/sloppy_slut__420","https://xelebrity.com/honeymoon1100","https://xelebrity.com/yayi_derek","https://xelebrity.com/ella_knockers_xl","https://xelebrity.com/twinksguys360","https://xelebrity.com/rosyemily","https://xelebrity.com/a_brazilian_man","https://xelebrity.com/naughtysammx","https://xelebrity.com/sexgoldi77","https://xelebrity.com/roselyn_rose","https://xelebrity.com/6_bunny_9","https://xelebrity.com/villanelle_l","https://xelebrity.com/bellapazzia13","https://xelebrity.com/sweet_ary","https://xelebrity.com/mishellerachell","https://xelebrity.com/cherylloving_","https://xelebrity.com/longdeepthroat23","https://xelebrity.com/minnie_jin","https://xelebrity.com/petalpage","https://xelebrity.com/mia_cloudy","https://xelebrity.com/tommyjoyer","https://xelebrity.com/alondra_on_fire","https://xelebrity.com/soffipink","https://xelebrity.com/lushianafitness","https://xelebrity.com/korinaluvv","https://xelebrity.com/corni__","https://xelebrity.com/splendid_dolls","https://xelebrity.com/_ifyouwant_","https://xelebrity.com/elektra_and_konan_01","https://xelebrity.com/cindy_luv","https://xelebrity.com/cum_police","https://xelebrity.com/harlowblake___","https://xelebrity.com/honey_moontsts","https://xelebrity.com/sweet__sugar","https://xelebrity.com/passionate_bonds","https://xelebrity.com/eliizabeth_roberts","https://xelebrity.com/marylou2000","https://xelebrity.com/mary_lepson","https://xelebrity.com/wapos__25","https://xelebrity.com/hotbella_","https://xelebrity.com/emilio_brandon","https://xelebrity.com/ashley_jones9","https://xelebrity.com/hot_temptation21","https://xelebrity.com/cute00kiara","https://xelebrity.com/magictandem","https://xelebrity.com/nakedpaint245477","https://xelebrity.com/touch_me_if_you_can","https://xelebrity.com/lil_eva","https://xelebrity.com/durio","https://xelebrity.com/nicolle_mitchelle","https://xelebrity.com/katiepeach_","https://xelebrity.com/miablueye","https://xelebrity.com/aubreeskinkyplayroom","https://xelebrity.com/jee__son","https://xelebrity.com/sara_and_lion","https://xelebrity.com/kissmesloww","https://xelebrity.com/marius_vexley","https://xelebrity.com/vanessa_love","https://xelebrity.com/loolashow","https://xelebrity.com/tastypoint","https://xelebrity.com/kitty__sophie","https://xelebrity.com/lusty_freya","https://xelebrity.com/evalims","https://xelebrity.com/angelsofaurora","https://xelebrity.com/sexyscouple","https://xelebrity.com/uindi","https://xelebrity.com/meganstacy"],"scraper_engine":"Puppeteer (Enhanced)","screenshot_size_bytes":43410,"domSignals":{"lang":"en","canonical":"https://chaturbate.com/","hasLogin":true,"hasCheckout":false,"hasContact":true,"hasPolicy":true,"ogTitle":"Chaturbate - Free Adult Live Webcams!","ogSite":"","ogDescription":"Enjoy free chat and live webcam broadcasts from amateurs around the world. No registration required!"},"formRisks":[],"httpStatus":200,"finalUrl":"https://chaturbate.com/?next=%2Frosyemily%2F%3Fcampaign%3DQuUeA%26disable_sound%3D0%26join_overlay%3D1%26tour%3Dhr8m%26track%3Dxepebrity","htmlLength":1915695,"textLength":16430,"lowEvidenceRecovery":false,"parkingDetection":{"isParked":false},"otherpages":{"internalLinks":["https://xelebrity.com/agegate/incode/?key=gAAAAABpD4BiaKtWq1WqRIoUoY0NsL34-i-mD5vUE4NtmHyRQ5We_hKzCdOT7KVk6aLHztYzhy7aRqu40hgM2xkkakyfLVTz_JyhrvV50xgufUKdZCcno1Ewq01v8TFpAXJtHvDNGgsP&method=incode"],"internalPageContents":["Not Found\n\nThe requested URL was not found on this server.\n\nAdditionally, a 404 Not Found error was encountered while trying to use an ErrorDocument to handle the request."]}},"webrisk":{"overall_risk":"unknown","threats":[],"malware":false,"social_engineering":false,"unwanted_software":false,"error":"Request failed with status code 400"},"metadata":{"preflight":{"bestUrl":"https://xelebrity.com","probes":[{"url":"https://xelebrity.com","ok":true,"status":200},{"url":"https://www.xelebrity.com","ok":false,"error":"timeout of 3000ms exceeded"},{"url":"http://xelebrity.com","ok":false,"error":"timeout of 3000ms exceeded"}],"zyteCheck":null},"best_url":"https://xelebrity.com","phase_a_duration_ms":3511,"phase_b_duration_ms":24658,"early_exit_reason":null,"tls_warnings":[],"zyte_preflight":null,"low_evidence_recovery":false},"virustotal":{"malicious":0,"suspicious":0,"total":0,"scanned":false},"evidence_coverage":"90","ai_result_latest":{"flag":"high_risk","rate":25,"about":"

        Detailed Analysis Report: Is xelebrity.com Safe and Legit?

        \n

        Website Overview and Purpose

        \n

        xelebrity.com is an adult entertainment platform that offers live webcam services featuring amateur and professional performers. The site allows users to engage in live chats and private shows, primarily targeting an adult audience looking for interactive adult content.

        \n

        Content Quality and User Experience

        \n

        Key Experience Highlights

        \n\n

        Claims Verification and Red Flags

        \n

        ⚠️ Red Flags Detected

        \n

        Several red flags have been identified that raise concerns about the legitimacy of the site:

        \n\n

        ⚠️ Caution Points

        \n\n

        Security Note: The site uses a basic SSL certificate, which does not guarantee the legitimacy of the business.

        \n

        Legitimacy and Reputation Assessment

        \n

        The domain has been operational for 8 years, indicating some level of stability. However, it lacks a strong reputation in the adult entertainment industry, as evidenced by its absence from major rankings or reviews. The site is hosted in the United States, but there are no clear indicators of regulatory compliance or transparency regarding ownership.

        \n

        Final Verdict and Recommendations

        \n

        Conclusion: xelebrity.com raises multiple red flags that suggest it may not be a safe or legitimate platform for users. Caution is advised when engaging with adult entertainment sites, especially those that require personal information for age verification.

        \n

        Users should consider alternative platforms with better reputations and transparency regarding their operations.

        ","status":"scam","reasons":["[BUSINESS MODEL] The site operates in the high-risk adult entertainment sector, which often faces scrutiny for compliance and ethical issues.","[TRANSPARENCY] Lack of clear ownership information and regulatory compliance raises concerns about legitimacy.","[DOMAIN HISTORY] The domain is 8 years old, which is relatively young for an adult site, indicating a lack of established reputation.","[SECURITY] Basic SSL certificate in use, which does not guarantee the site's legitimacy or security.","[CLAIMS] The site makes unverifiable claims about user engagement and performer quality, which is common in scam patterns."],"category":"Adult Entertainment","red_flags":["[GUARDRAIL] No deterministic evidence for scam; downgrading to warning","[CLAIMS] Age verification process may be a tactic to collect sensitive personal information.","[CONTENT QUALITY] Explicit content may not be suitable for all users, raising ethical concerns.","[BUSINESS MODEL] High-risk category for adult entertainment sites, often associated with scams."],"final_score":25,"subcategory":"General","final_status":"warning","score_source":"openai_guardrail","ai_confidence":"medium","claimed_brand":null,"brand_evidence":[],"business_model":"Live webcam services and adult content","expected_domain":null,"target_audience":"Adults seeking live adult entertainment","confidence_level":"medium","guardrail_actions":[{"type":"scam_downgraded","reason":"No deterministic evidence for scam; downgrading to warning","scoreCeiling":null,"targetStatus":"warning"}],"analysis_timestamp":"2025-11-08T17:41:11.637Z","user_recommendation":"Exercise caution and consider alternative platforms with better reputations.","contact_transparency":"poor","professionalism_score":4,"brand_claim_confidence":null},"final_domain_age":{"days":3191,"years":8,"source":"ct_logs","verified":true,"allSources":["ct_logs"]},"guardrail_summary":{"actions":[{"type":"scam_downgraded","reason":"No deterministic evidence for scam; downgrading to warning","scoreCeiling":null,"targetStatus":"warning"}],"scoreSource":"openai_guardrail","aiConfidence":"medium"}},"reviews":[],"has_archive":false,"archive_data":null,"archive_stats":null}};