← Back to Home

live69cams.com Scam Check: 25/100 Trust | ScamMinder

Website: live69cams.com

Screenshot of live69cams.com

Safety Score

25/100
✗ Scam Risk

Exercise caution when interacting with this website.

AI Analysis Results

Category: Adult Entertainment
About this website:

Detailed Analysis Report: Is Live69Cams.com Safe and Legit? Website Overview and Purpose Live69Cams.com is a live webcam platform that offers adult entertainment through live broadcasts from performers. The site targets an audience of adults over 18 years old, providing a space for users to engage in private shows and chat with models. The platform emphasizes user privacy and age verification to comply with legal standards. Content Quality and User Experience Key Experience Highlights Age verification process to ensure compliance with legal requirements. Variety of performers categorized by gender and preferences. Token-based system for private shows and interactions. Mobile-friendly design for accessibility on various devices. Claims Verification and Red Flags ⚠️ Red Flags Detected Several red flags indicate potential issues with the legitimacy of the site: Age Verification Concerns: The site requires users to verify their age, which is common in adult sites but can be a tactic to collect personal information. Token System: The reliance on a token system for interactions raises concerns about transparency and potential hidden fees. Privacy Policy: The site mentions cookies and tracking technologies but lacks clarity on data usage and user rights. High-Risk Category: Adult entertainment sites often face scrutiny for compliance with legal standards and user safety. Domain Age: The domain is 6 years old, which is relatively young for a site in this industry, raising questions about its stability and reputation. ⚠️ Caution Points Users should be cautious about sharing personal information and verify the site's legitimacy before engaging. Check for secure payment methods and read user reviews before purchasing tokens. Security Note: The site uses a valid SSL certificate, but this does not guarantee overall safety. Legitimacy and Reputation Assessment The domain has been operational for 6 years , indicating some level of stability. However, the lack of extensive archive history and the nature of the adult entertainment industry raise concerns. The site is hosted in the US, but the absence of clear company information and contact details diminishes trust. Final Verdict and Recommendations Conclusion: Live69Cams.com presents several red flags that suggest it may not be a safe platform for users. Caution is advised when engaging with adult entertainment sites, especially those with unclear policies and high-risk business models. Users should verify the site's legitimacy, read reviews, and be cautious about sharing personal information or making purchases.

Risk Assessment: scam
⚠️ Red Flags:
  • [GUARDRAIL] No deterministic evidence for scam; downgrading to warning
  • [CLAIMS] Age verification process may be a tactic to collect personal information.
  • [BUSINESS] Token-based system raises concerns about transparency and potential hidden fees.
  • [TRANSPARENCY] Lack of clear company information and contact details.
  • [AGE VERIFICATION] Requirement for age verification can be a tactic to collect personal information.
📊 Analysis Reasons:
  • [BUSINESS MODEL] The site operates on a token-based system, which can lead to hidden fees and unclear pricing.
  • [TRANSPARENCY] Lack of clear company information and contact details raises concerns about accountability.
  • [AGE VERIFICATION] The requirement for age verification can be a tactic to collect personal information.
  • [DOMAIN HISTORY] The domain is only 6 years old, which is relatively young for a site in the adult entertainment industry.
  • [SECURITY] While the site has a valid SSL certificate, this does not guarantee overall safety or legitimacy.
🛡️ Safety Actions Applied:
  • {"type":"scam_downgraded","reason":"No deterministic evidence for scam; downgrading to warning","scoreCeiling":null,"targetStatus":"warning"}
Score Source: openai_guardrail
AI Confidence: medium

Technical Details

\n \n\n\n\n\n\n\n\n\n \n \n \n \n\n \n\n \n \n \n\n\n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n\n\n \n \n Live Girls Free 69 Cams\n\n\n \n \n \n \n \n \n \n \n \n \n \n \n \n\n \n\n \n \n \n \n \n\n\n \n \n \n \n\n \n \n \n \n \n\n \n \n\n\n \n \n \n\n \n \n\n\n\n\n\n \n\n\n\n\n\n \n\n \n \n\n\n \n \n \n\n\n\n\n\n \n \n\n\n\n\n\n \n\n\n
\n\n\n\n \n \n\n
\n\n \n\n
\n
\n \n Verify your age\n \n
\n \n \n Visitors in Florida must verify their age to access Live69Cams.Com.\n This process will take under 1 minute.\n \n \n \n
\n

\nAlthough this platform is, and has always been, for adults only, as it appears you are accessing the platform from Florida, you will need to take the additional step of verifying your age. For your information, your verification information or image is not provided to or reviewed by the platform. We receive only confirmation that you have successfully verified your age.\n

\n

\n\n\n \n The law does not — by its own terms — apply to any Internet service provider or cloud service provider that solely provides access to content from a facility (in this case, a webcam) not under its control.\n \n This platform is not responsible for the creation or production of any of the content appearing through the platform. Our sole functions with respect to the platform are to ensure its effective operation (notably, ensuring that the content and users comply with the Terms of Service) and safety of the community (most importantly, ensuring that no minors appear through the platform).\n\n

\n
\n
\n \n
\n \n
\n
\n \n \n
\n
\n
\n \n
\n

Verify your age by taking a photo of your driver's license or passport. This image will not be provided to us and will be discarded by Incode immediately after confirming your age.

\n
\n
\n
\n
\n \n
\n \n
\n \n
\n
\n \n \n
\n
\n
\n \n
\n

Verify your age using the Yoti app. Yoti will store your identification information to make future verifications simpler.

\n
\n
\n
\n
\n \n
\n \n \n \n Other verification methods\n \"caret\"\n \n \n \n
\n \n Confirm Age\n \n \n
\n\n\n\n\n\n
\n\n\n\n\n\n\n \n\n\n \n\n\n
\n
\n
\n

YOU MUST BE OVER 18 AND AGREE TO THE TERMS BELOW BEFORE CONTINUING:

\n
\n
\n \n

This website contains information, links, images and videos of sexually explicit material (collectively, the \"Sexually Explicit Material\"). Do NOT continue if: (i) you are not at least 18 years of age or the age of majority in each and every jurisdiction in which you will or may view the Sexually Explicit Material, whichever is higher (the \"Age of Majority\"), (ii) such material offends you, or (iii) viewing the Sexually Explicit Material is not legal in each and every community where you choose to view it.

\n

By choosing to enter this website you are affirming under oath and penalties of perjury pursuant to Title 28 U.S.C. § 1746 and other applicable statutes and laws that all of the following statements are true and correct:

\n
    \n
  • I have attained the Age of Majority in my jurisdiction;
    • \n
  • The sexually explicit material I am viewing is for my own personal use and I will not expose any minors to the material;\n
    • \n
  • I desire to receive/view sexually explicit material;
    • \n
  • I believe that as an adult it is my inalienable constitutional right to receive/view sexually explicit material;\n
    • \n
  • I believe that sexual acts between consenting adults are neither offensive nor obscene;\n
    • \n
  • The viewing, reading and downloading of sexually explicit materials does not violate the standards of any community, town, city, state or country where I will be viewing, reading and/or downloading the Sexually Explicit Materials;\n
    • \n
  • I am solely responsible for any false disclosures or legal ramifications of viewing, reading or downloading any material appearing on this site. I further agree that neither this website nor its affiliates will be held responsible for any legal ramifications arising from any fraudulent entry into or use of this website;\n
    • \n \n
  • I understand that this website uses cookies, web beacons, tracking pixels, and similar tracking technologies, as more fully described in the website's Privacy Policy, and I hereby consent to the use of such tracking technologies;\n
    • \n \n
  • I understand that my use of this website is governed by the website's Terms which I have reviewed and accepted, and I agree to be bound by such Terms.\n
    • \n
  • I agree that by entering this website, I am subjecting myself, and any business entity in which I have any legal or equitable interest, to the personal jurisdiction of the State of California, Los Angeles County, should any dispute arise at any time between this website, myself and/or such business entity;\n
    • \n
  • This warning page constitutes a legally binding agreement between me, this website and/or any business in which I have any legal or equitable interest. If any provision of this Agreement is found to be unenforceable, the remainder shall be enforced as fully as possible and the unenforceable provision shall be deemed modified to the limited extent required to permit its enforcement in a manner most closely representing the intentions as expressed herein;\n
    • \n
  • All performers on this site are over the age of 18, have consented being photographed and/or filmed, believe it is their right to engage in consensual sexual acts for the entertainment and education of other adults and I believe it is my right as an adult to watch them doing what adults do;\n
    • \n
  • The videos and images in this site are intended to be used by responsible adults as sexual aids, to provide sexual education and to provide sexual entertainment;\n
    • \n
  • I understand that providing a false declaration under the penalties of perjury is a criminal offense; and\n
    • \n
  • I agree that this agreement is governed by the Electronic Signatures in Global and National Commerce Act (commonly known as the \"E-Sign Act\"), 15 U.S.C. § 7000, et seq., and by choosing to click on \"I Agree\" and indicating my agreement to be bound by the terms of this agreement, I affirmatively adopt the signature line below as my signature and the manifestation of my consent to be bound by the terms of this agreement.\n
    • \n
\n\n
\n Signed:\n /s/ \n
\n\n
\n

THIS SITE ACTIVELY COOPERATES WITH LAW ENFORCEMENT IN ALL INSTANCES OF SUSPECTED ILLEGAL USE OF THE SERVICE, ESPECIALLY IN THE CASE OF UNDERAGE USAGE OF THE SERVICE.

\n
\n Exit\n I AGREE\n
\n\n

\n \"Safe\n \"RTA\n \"Approved\n

\n
\n
\n\n\n \n\n\n \n\n\n \n\n\n\n\n\n\n\n\n
\n
\n \n\n\n\n
\n
\n
\n \n \n \n \n \n \n\n Live Adult WebCams Nude Girls and Couples\n
\n\n \n\n
\n
\n
\n
\n \"Anonymous\n \n \n
\n\n \n \n \n \n
\n \n \n \n
\n \n \n
\n \n
\n
\n \n \n \n \n \n \n \n\n\n \n \n \n \n
Status:\n \n Anonymous\n \n (Log In)
You have:\n
\n \n \n\n 0 Tokens\n\n \n \n
\n 		\n (Get More)\n
\n
\n
\n
\n\n
\n\n \n
\n \n
\n\n
\n\n\n\n\n\n
\n
\n
\n
\n We noticed you're using a web browser that we don't support. Upgrade to a recent version of
Chrome, Firefox, or Safari for a better online experience. (dismiss)\n
\n
\n
\n \n \n \n \n \n \n\n \n \n \n \n \n
×
We've improved Live69Cams.Com's mobile site by adding these feature(s):
  • My Collection
  • Satisfaction Voting
  • Report Room
Visit the mobile site again, or give us some feedback on why you left
\n\n \n
\n \n \n \n \n
    • Filters
\n \n
REGIONS
North AmericaSouth AmericaAsiaEurope/RussiaOther
ROOM SIZE
IntimateMid-SizedHigh-Traffic
TAGS
ebonybigboobs18asianmaturemilfanalsquirtlatinanewhairybbwteenfuckmachinebigassdeepthroatskinnymilkfeetsmalltitspantyhosepregnantpinayyoungbritishbigcockmusclebbcgermancurvymistressgothshylesbianindianredheadsmokenaturalc2cblondelovensefrenchbigpussylipscumpetitenonudedaddysaliva
1
of
17
1 / 17
next
AGES
(reset)

to

apply
PRIVATE SHOW TOKENS PER MINUTE
6 tks12 - 18 tks30 - 42 tks60 - 72 tks90+ tks
\n \n\n \n
\n \n \n \n \n\n
\n

Options

Upgrade to supporter to use this feature.
\n
\n
\n\n \n
\n \n \n\n \n

Online Rooms

Offline Rooms

Clear All
Search results for \"\"

No Results Found - None of the 7,573 live rooms matched your filters. Please update your search/filter options.
Suggestions:
  • Remove some of the filter options
  • Try different filters
  • Clear all filters

Something went wrong while loading the rooms. Please refresh the page to try again.

4928 of the 7573 live rooms matched your filters

Community Controlled Shows

No Results Found - None of the 0 live rooms matched your filters. Please update your search/filter options.
Suggestions:
  • Remove some of the filter options
  • Try different filters
  • Clear all filters

Something went wrong while loading the rooms. Please refresh the page to try again.

    None of the undefined community controlled rooms matched your filters
      • ...
    • 1
      • ...

    Recommended For You

      Other Featured Cams:

      Something went wrong while loading the rooms. Please refresh the page to try again.

        \n \n \n \n
        \n\n \n\n
        ×
        We've improved Live69Cams.Com's mobile site by adding these feature(s):
        • My Collection
        • Satisfaction Voting
        • Report Room
        Visit the mobile site again, or give us some feedback on why you left
        Room is currently offline
        SEND TIPSEND MESSAGE
        More Rooms
        Spy has been disabled by the broadcaster.
        Broadcaster's stream is experiencing network issues
        \"Volume\"

        \"Video

        \"Private\"

        Private

        \"Cam

        Cam To Cam

        \"Send

        Send Tip

        \"Chat\"

        Chat

        \"Users\"

        Users

        \"More

        More Rooms

        \"Theater

        \"Fullscreen\"

        \"Switch

        Native Fullscreen
        Interactive Fullscreen
        CHAT
        PM
        \"😁\"TIP
        VIEW / REPORT EMOTICON
        Scroll to bottom
        my long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long string
        \"Search\"
        Font Settings
        Emoticons Settings
        Users Settings
        Notifications Settings
        Other Settings
        TIP
        Chat settings saved
        signup to chat -- totally free, no email needed
        You currently have: 0 tokens
        Promote This Room

        You must be logged in to promote the room.

        You must be logged in to share your cam

        Cam To Cam

        Spying is unavailable.

        Start Private Show
        This broadcaster doesn't accept tips.
        SEND TIP
        CHAT
        PM
        USERS (0)
        . . .
        Scroll to bottom
        \"😁\"
        VIEW / REPORT EMOTICON
        my long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long stringmy long string
        \"Search\"
        Loading user list...
        Font Settings
        Emoticons Settings
        Users Settings
        Notifications Settings
        Other Settings
        FOLLOW
        UNFOLLOW
        Join Fan Club
        Follow broadcasters to receive instant notifications when they come online.
        Filter by: Newest First
        Filter by: Newest First
        loading...
        Here are some trending rooms instead:
          loading...
          Token Link codes
          Earn up to 10 tokens for every registered user and 500 tokens for users who broadcast (broadcasters must earn $20.00 before they qualify).
          Please send to chaturbate using one of the link codes below.

          This room requires a password.

           
           
          Send a tip
          Your current balance:Purchase Tokens
          WARNING: This room has a low satisfaction rating.
          TIP AT YOUR OWN RISK!
          Include an optional message:
          Toggle this window with Ctrl+S
          Public Tipping
          Username is visible to all users.
          You must be a supporter to use this feature.
          Anonymous Tipping
          Username only visible to broadcaster.
          \n \n
          \n \n\n
          \n
          \n

          Free Cams by Age

          \n \n \n\n\n
          \n \n
          \n Teen Cams (18+)\n
          \n \n
          \n 18 to 21 Cams\n
          \n \n
          \n 20 to 30 Cams\n
          \n \n
          \n 30 to 50 Cams\n
          \n \n
          \n Mature Cams (50+)\n
          \n \n
          \n\n\n
          \n
          \n

          Free Cams by Region

          \n \n \n\n\n
          \n \n
          \n North American Cams\n
          \n \n
          \n Other Region Cams\n
          \n \n
          \n Euro Russian Cams\n
          \n \n
          \n Asian Cams\n
          \n \n
          \n South American Cams\n
          \n \n
          \n\n\n
          \n
          \n

          Available Private Shows

          \n \n \n\n\n
          \n \n
          \n 6 Tokens per Minute\n
          \n \n
          \n 12-18 Tokens per Minute\n
          \n \n
          \n 30-42 Tokens per Minute\n
          \n \n
          \n 60-72 Tokens per Minute\n
          \n \n
          \n 90+ Tokens per Minute\n
          \n \n
          \n\n\n
          \n
          \n

          Free Cams by Status

          \n \n \n\n\n
          \n \n
          \n Private Shows\n
          \n \n
          \n New Cams\n
          \n \n
          \n Gaming Cams\n
          \n \n
          \n\n\n
          \n
          \n

          Free Cams

          \n \n \n\n\n
          \n \n
          \n Featured Cams\n
          \n \n
          \n Female Cams\n
          \n \n
          \n Male Cams\n
          \n \n
          \n Couple Cams\n
          \n \n
          \n Trans Cams\n
          \n \n
          \n\n\n
          \n
          \n\n \n \n \n

          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n
          \n

          \n
          \n
          \n

          \nRATE US\n

          \n

          \nJust Directory.org\n

          \n

          \n

          \n

          \n \n \n \n \n \n \n \n\n

          18 U.S.C. 2257 Record Keeping Requirements Compliance Statement

          \n\n\n

          © Copyright Www.live69cams.com 2011 - 2025. All Rights Reserved.
          www3-ext-7k7h:65eaa17f9233:99cc92d7fb1fe0f4-MIA

          \n

          \n \"Safe\n \"RTA\n \"Approved\n

          \n\n \n

          Whitelabel powered by Chaturbate.com

          \n\n
          \n \n \n \n
          \n\n\n\n\n\n\n\n\n\n\n\n\n \n \n \n\n\n\n\n\n\n \n\n \n\n \n \n \n \n \n\n \n\n \n\n \n \n\n \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n \n \n \n \n \n\n\n\n\n\n\n\n\n\n\n\n\n
          word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word word

          mmMwWLliI0fiflO&1
          mmMwWLliI0fiflO&1
          mmMwWLliI0fiflO&1
          mmMwWLliI0fiflO&1
          mmMwWLliI0fiflO&1
          mmMwWLliI0fiflO&1
          mmMwWLliI0fiflO&1\n\n\n\n\n\n\n\n\n\n\n\n\n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n\n\n\n\n\n\n\n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n \n
          \n \n \n \n\n\n
          \n\n\n\n\n\n\n\n\n \n\n\n
          \n
          ","screenshot":"https://cdn.scamminder.com/include/uploads/2025/11/live69cams.com-20251111-035613.webp","loadTimeInSeconds":8.016,"title":"Live Girls Free 69 Cams","keywords":"","description":"Enjoy free chat and live webcam broadcasts from amateurs around the world. No registration required!","links":["https://live69cams.com/agegate/incode/?key=gAAAAABpEvodMHdzYXUugKbMITXXQiTT7jve2MM_nfco-mSrghjHWE0qVCYomWC1U4XyHxJXldT_tr40Mfvr2pJJTqd92VQySAee6gzU_TiseEmGWFphoGetd8MB8OII1KZhgmqhlFyc&method=incode","https://live69cams.com/auth/login","https://live69cams.com/privacy","https://live69cams.com/terms","https://live69cams.com","https://live69cams.com/accounts/register/?src=header","https://live69cams.com/tipping/purchase_tokens/?source=TokenSourceUserInfoPanel","https://live69cams.com/accounts/register","https://live69cams.com/discover","https://live69cams.com/tags","https://live69cams.com/spy-on-cams","https://live69cams.com/followed-cams","https://live69cams.com/accounts/register/?src=broadcast&next=/b","https://live69cams.com/?mobile_site=1","https://www.live69cams.com","https://www.live69cams.com/female-cams","https://www.live69cams.com/male-cams","https://www.live69cams.com/couple-cams","https://www.live69cams.com/trans-cams","https://www.live69cams.com/north-american-cams","https://www.live69cams.com/south-american-cams","https://www.live69cams.com/asian-cams","https://www.live69cams.com/euro-russian-cams","https://www.live69cams.com/other-region-cams","https://www.live69cams.com/?room_size=sm","https://www.live69cams.com/?room_size=md","https://www.live69cams.com/?room_size=lg","https://www.live69cams.com/tag/ebony","https://www.live69cams.com/tag/bigboobs","https://www.live69cams.com/tag/18","https://www.live69cams.com/tag/asian","https://www.live69cams.com/tag/mature","https://www.live69cams.com/tag/milf","https://www.live69cams.com/tag/anal","https://www.live69cams.com/tag/squirt","https://www.live69cams.com/tag/latina","https://www.live69cams.com/tag/new","https://www.live69cams.com/tag/hairy","https://www.live69cams.com/tag/bbw","https://www.live69cams.com/tag/teen","https://www.live69cams.com/tag/fuckmachine","https://www.live69cams.com/tag/bigass","https://www.live69cams.com/tag/deepthroat","https://www.live69cams.com/tag/skinny","https://www.live69cams.com/tag/milk","https://www.live69cams.com/tag/feet","https://www.live69cams.com/tag/smalltits","https://www.live69cams.com/tag/pantyhose","https://www.live69cams.com/tag/pregnant","https://www.live69cams.com/tag/pinay","https://www.live69cams.com/tag/young","https://www.live69cams.com/tag/british","https://www.live69cams.com/tag/bigcock","https://www.live69cams.com/tag/muscle","https://www.live69cams.com/tag/bbc","https://www.live69cams.com/tag/german","https://www.live69cams.com/tag/curvy","https://www.live69cams.com/tag/mistress","https://www.live69cams.com/tag/goth","https://www.live69cams.com/tag/shy","https://www.live69cams.com/tag/lesbian","https://www.live69cams.com/tag/indian","https://www.live69cams.com/tag/redhead","https://www.live69cams.com/tag/smoke","https://www.live69cams.com/tag/natural","https://www.live69cams.com/tag/c2c","https://www.live69cams.com/tag/blonde","https://www.live69cams.com/tag/lovense","https://www.live69cams.com/tag/french","https://www.live69cams.com/tag/bigpussylips","https://www.live69cams.com/tag/cum","https://www.live69cams.com/tag/petite","https://www.live69cams.com/tag/nonude","https://www.live69cams.com/tag/daddy","https://www.live69cams.com/tag/saliva","https://www.live69cams.com/6-tokens-per-minute-private-cams","https://www.live69cams.com/12-18-tokens-per-minute-private-cams","https://www.live69cams.com/30-42-tokens-per-minute-private-cams","https://www.live69cams.com/60-72-tokens-per-minute-private-cams","https://www.live69cams.com/90-tokens-per-minute-private-cams","https://live69cams.com/supporter/upgrade/?source=SupporterSourcePreviewRoomsUpsell","https://www.live69cams.com/followed-cams","https://www.live69cams.com/followed-cams/offline","https://live69cams.com/elisparadisex","https://live69cams.com/tinyangelxx","https://live69cams.com/laneystone","https://www.live69cams.com/tag/brunette","https://live69cams.com/ella_lee15","https://live69cams.com/inkanuko","https://www.live69cams.com/tag/analplug","https://www.live69cams.com/tag/pussyplay","https://live69cams.com/heyskylar","https://live69cams.com/vivianwinters","https://live69cams.com/xiaobrunscheen","https://www.live69cams.com/tag/couple","https://live69cams.com/blessmyass","https://www.live69cams.com/tag/tease","https://www.live69cams.com/tag/joi","https://live69cams.com/ginacali","https://www.live69cams.com/tag/bigtits"],"scraper_engine":"Puppeteer (Enhanced)","screenshot_size_bytes":82660,"domSignals":{"lang":"en","canonical":"https://chaturbate.com/","hasLogin":true,"hasCheckout":false,"hasContact":true,"hasPolicy":true,"ogTitle":"Live69cams.Com - Free Adult Live Webcams!","ogSite":"","ogDescription":"Enjoy free chat and live webcam broadcasts from amateurs around the world. No registration required!"},"formRisks":[],"httpStatus":200,"finalUrl":"https://www.live69cams.com/","htmlLength":1919550,"textLength":20937,"lowEvidenceRecovery":false,"parkingDetection":{"isParked":false},"otherpages":{"internalLinks":["https://live69cams.com/agegate/incode/?key=gAAAAABpEvodMHdzYXUugKbMITXXQiTT7jve2MM_nfco-mSrghjHWE0qVCYomWC1U4XyHxJXldT_tr40Mfvr2pJJTqd92VQySAee6gzU_TiseEmGWFphoGetd8MB8OII1KZhgmqhlFyc&method=incode"],"internalPageContents":[""]}},"webrisk":{"overall_risk":"unknown","threats":[],"malware":false,"social_engineering":false,"unwanted_software":false,"error":"Request failed with status code 400"},"metadata":{"preflight":{"bestUrl":"https://live69cams.com","probes":[{"url":"https://live69cams.com","ok":true,"status":200},{"url":"https://www.live69cams.com","ok":true,"status":200},{"url":"http://live69cams.com","ok":true,"status":200}],"zyteCheck":null},"best_url":"https://live69cams.com","phase_a_duration_ms":3508,"phase_b_duration_ms":21379,"early_exit_reason":null,"tls_warnings":[],"zyte_preflight":null,"low_evidence_recovery":false},"virustotal":{"malicious":0,"suspicious":0,"total":90,"scanned":true},"archive_gap":{"suspicious":1,"details":{"domain_age_days":0,"total_snapshots":186,"unique_snapshots":127,"snapshot_span_days":5567,"first_snapshot":"2010-01-18","last_snapshot":"2025-04-16","consistency_analysis":{"avg_snapshots_per_month":1.96,"months_with_snapshots":95,"gap_count":89,"longest_gap_months":10,"longest_recent_gap_months":4},"yearly_activity":[{"year":2020,"count":4,"months_active":4,"active":true},{"year":2021,"count":2,"months_active":2,"active":true},{"year":2022,"count":5,"months_active":3,"active":true},{"year":2023,"count":1,"months_active":1,"active":true},{"year":2024,"count":12,"months_active":4,"active":true},{"year":2025,"count":9,"months_active":2,"active":true}],"recent_gaps":{"recent_gap_count":10,"longest_recent_gap":7},"suspicious_score":1,"suspicious_reasons":["Extremely new domain (<60 days) with disproportionate coverage"]},"reasons":[]},"evidence_coverage":"90","guardrail_summary":{"actions":[{"type":"scam_downgraded","reason":"No deterministic evidence for scam; downgrading to warning","scoreCeiling":null,"targetStatus":"warning"}],"scoreSource":"openai_guardrail","aiConfidence":"medium"}},"reviews":[],"has_archive":false,"archive_data":null,"archive_stats":null}};